An Immunosuppressant Peptide from the Hard Tick Amblyomma variegatum.

نویسندگان

  • Yufeng Tian
  • Wenlin Chen
  • Guoxiang Mo
  • Ran Chen
  • Mingqian Fang
  • Gabriel Yedid
  • Xiuwen Yan
چکیده

Ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1-2 weeks to obtain blood meals. Thus, they must secrete many immunosuppressant factors to combat the hosts' immune system. In the present work, we investigated an immunosuppressant peptide of the hard tick Amblyomma variegatum. This peptide, named amregulin, is composed of 40 residues with an amino acid sequence of HLHMHGNGATQVFKPRLVLKCPNAAQLIQPGKLQRQLLLQ. A cDNA of the precursor peptide was obtained from the National Center for Biotechnology Information (NCBI, Bethesda, MD, USA). In rat splenocytes, amregulin exerts significant anti-inflammatory effects by inhibiting the secretion of inflammatory factors in vitro, such as tumor necrosis factor-alpha (TNF-α), interleukin-1 (IL-1), interleukin-8 (IL-8) and interferon-gamma (IFN-γ). In rat splenocytes, treated with amregulin, compared to lipopolysaccharide (LPS) alone, the inhibition of the above inflammatory factors was significant at all tested concentrations (2, 4 and 8 µg/mL). Amregulin shows strong free radical scavenging and antioxidant activities (5, 10 and 20 µg/mL) in vitro. Amregulin also significantly inhibits adjuvant-induced paw inflammation in mouse models in vivo. This peptide may facilitate the ticks' successful blood feeding and may lead to host immunotolerance of the tick. These findings have important implications for the understanding of tick-host interactions and the co-evolution between ticks and the viruses that they bear.

برای دانلود رایگان متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

ثبت نام

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

VECTOR-BORNE DISEASES, SURVEILLANCE, PREVENTION New Approaches to Detection and Identification of Rickettsia africae and Ehrlichia ruminantium in Amblyomma variegatum (Acari: Ixodidae) Ticks From the Caribbean

Imported from Africa in the 1700s and despite frequent modern eradication efforts, Amblyomma variegatum (F.) spread through the Caribbean by cattle transport, small ruminants, and migrating birds. A. variegatum is a vector for Rickettsia africae, the causative agent of African tick bite fever, and Ehrlichia ruminantium, the causative agent of heartwater. We examined 95 A. variegatum and six Rhi...

متن کامل

Propagation of the tick Amblyomma variegatum in the Caribbean.

The tropical bont tick, Amblyomma variegatum, is an African tick species which infests livestock and wildlife. It was probably introduced in the central eastern islands of the Caribbean during the 18th or 19th century, with cattle shipped from Senegal. In Africa and the Caribbean, this tick is a vector of heartwater (a rickettsial disease of ruminants) and is associated with acute dermatophilos...

متن کامل

Progress towards a program for the eradication of Amblyomma variegatum from the Caribbean.

Amblyomma variegatum (Fabricius), the tropical bont tick, is now widely distributed in the Caribbean. Eighteen islands countries are now or were recently infested with the tick. To stop the spread of this tick to other non-infested islands and to the mainland areas of South, Central and North America, a regional eradication program has been proposed and endorsed by the respective governments on...

متن کامل

Ixodid Tick Infestation in Cattle and Wild Animals in Maswa and Iringa, Tanzania

Ticks and tick-borne diseases are important in human and livestock health worldwide. In November 2012, ixodid ticks were collected and identified morphologically from cattle and wild animals in the Maswa district and Iringa urban, Tanzania. Amblyomma gemma, A. lepidum, and A. variegatum were identified from Maswa cattle, and A. variegatum was the predominant species. A. marmoreum, Hyalomma impe...

متن کامل

Variability of cattle infestation by Amblyomma variegatum and its possible utilisation for tick control.

A great variability of the individual infestation by Amblyomma variegatum adults was observed on naturally infested Gudali zebus. Some of the animals (called "attractive for A. variegatum") had a tick burden 10 to 16 times higher than that of the least parasitized cattle of the herd (called "non-attractive"). Ranking of the animals based on A. variegatum infestation was correlated for successiv...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

عنوان ژورنال:
  • Toxins

دوره 8 5  شماره 

صفحات  -

تاریخ انتشار 2016